Skip to content

Synthetic AAV-PHP.eB Capsid Protein Gene, Complete Cds

1 atggctgccg atggttatct tccagattgg ctcgaggaca accttagtga aggaattcgc 61 gagtggtggg ctttgaaacc tggagcccct caacccaagg caaatcaaca acatcaagac 121 aacgctcgag gtcttgtgct tccgggttac aaataccttg gacccggcaa cggactcgac 181 aagggggagc cggtcaacgc agcagacgcg gcggccctcg agcacgacaa ggcctacgac 241 cagcagctca […]

Cas9 Species/Variants and PAM Sequences

Species/Variant of Cas9 PAM Sequence Streptococcus pyogenes (SP); SpCas9 NGG SpCas9 D1135E variant NGG (reduced NAG binding) SpCas9 VRER variant NGCG SpCas9 EQR variant NGAG SpCas9 VQR variant NGAN or […]

Codon optimized PEST sequence

5′-TCC CAC GGC TTC CCC CCC GAG GTC GAG GAG CAG GCC GCC GGC ACC CTC CCC ATG AGC TGC GCC CAG GAG AGC GGC ATG GAC AGG CAC CCC […]

AAV VP1 Sequence Blast Serotype 9 vs Serotype PHP.B

Query 1 MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLD 60 MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLD Sbjct 1 MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLD 60 Query 61 KGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQ 120 KGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQ Sbjct 61 KGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQ 120 Query 121 AKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTE 180 AKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTE Sbjct 121 AKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTE 180 Query 181 SVPDPQPIGEPPAAPSGVGSLTMASGGGAPVADNNEGADGVGSSSGNWHCDSQWLGDRVI […]