Skip to content

List of Protein Tags

Peptide tags

  • AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE)
  • Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL)
  • polyglutamate tag, a peptide binding efficiently to anion-exchange resin such as Mono-Q (EEEEEE)
  • E-tag, a peptide recognized by an antibody (GAPVPYPDPLEPR)
  • FLAG-tag, a peptide recognized by an antibody (DYKDDDDK)
  • HA-tag, a peptide recognized by an antibody (YPYDVPDYA)
  • His-tag, 5-10 histidines bound by a nickel or cobalt chelate (HHHHHH)
  • Myc-tag, a short peptide recognized by an antibody (EQKLISEEDL)
  • S-tag (KETAAAKFERQHMDS)
  • SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP)
  • Softag 1, for mammalian expression (SLAELLNAGLGGS)
  • Softag 3, for prokaryotic expression (TQDPSRVG)
  • Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK)
  • TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC)
  • V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST)
  • VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK)
  • Xpress tag (DLYDDDDK)

Covalent peptide tags

  • Isopeptag, a peptide which binds covalently to pilin-C protein (TDKDMTITFTNKKDAE)
  • SpyTag, a peptide which binds covalently to SpyCatcher protein (AHIVMVDAYKPTK)

Protein tags

  • BCCP (Biotin Carboxyl Carrier Protein), a protein domain biotinylated by BirA enabling recognition by streptavidin
  • Glutathione-S-transferase-tag, a protein which binds to immobilized glutathione
  • Green fluorescent protein-tag, a protein which is spontaneously fluorescent and can be bound by nanobodies
  • Halo-tag, a mutated hydrolase that covalently attaches to the HaloLink™ Resin
  • Maltose binding protein-tag, a protein which binds to amylose agarose
  • Nus-tag
  • Thioredoxin-tag
  • Fc-tag, derived from immunoglobulin Fc domain, allow dimerization and solubilization. Can be used for purification on Protein-A Sepharose
  • Designed Intrinsically Disordered tags containing disorder promoting amino acids (P,E,S,T,A,Q,G,..)