MAADGYLPDWLEDNLSEGIREWWDLKPGAPKPKANQQKQDNGRGLVLPGYKYLGPFNGLDKGEPVNAADAAALEHDKAYDQQLQAGDNPYLRYNHADAEFQERLQEDTSFGGNLGRAVFQAKKRVLEPLGLVESPVKTAPGKKRPVEPSPQRSPDSSTGIGKKGQQPAKKRLNFGQTGDSESVPDPQPIGEPPAGPSGLGSGTMAAGGGAPMADNNEGADGVGSSSGNWHCDSTWLGDRVITTSTRTWALPTYNNHLYKQISNGTSGGSTNDNTYFGYSTPWGYFDFNRFHCHFSPRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTQNEGTKTIANNLTSTIQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMIPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFEFSYNFEDVPFHSSYAHSQSLDRLMNPLIDQYLYYLSRTQSTGGTAGTQQLLFSQAGPNNMSAQAKNWLPGPCYRQQRVSTTLSQNNNSNFAWTGATKYHLNGRDSLVNPGVAMATHKDDEERFFPSSGVLMFGKQGAGKDNVDYSSVMLTSEEEIKTTNPVATEQYGVVADNLQQQNAAPIVGAVNSQGALPGMVWQNRDVYLQGPIWAKIPHTDGNFHPSPLMGGFGLKHPPPQILIKNTPVPADPPTTFNQAKLASFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYYKSTNVDFAVNTEGTYSEPRPIGTRYLTRNL*
Recent Posts
- AAVrh.74 Capsid Sequence
- How to avoid cross-contamination in qPCR
- Reduce the risk of cross-contamination from the amplicon/template and previous reactions for a qPCR
- Difference between dye-based vs probe-based qPCR
- OmpA Signal for Protein Expression
- Isopycnic Centrifugation
- High-cell-density cultivation (HCDC)
- Is Kozak sequence essential for transgene expression in lentivirus?
- How to remove protein from PEG precipitated lentivirus
- Primers and probes used for rAAV quantitative analysis
- Quantification for residual host cell DNA contamination in the rAAV prep via qPCR or ddPCR analysis targeting highly repetitive genome sequences
- How to protect RNA from degradation?
- What is the main reason for RNA being unstable?
- Why Are Transgenes Cloned into Lentiviral Vectors Without a Poly(A) Signal?
- AAV(Myo1A)-CMV-GFP Ready to Package
- Potential Reasons for Lack of Supercoiled DNA
- Transfection Efficiency: What Makes Plasmid DNA Transfection Grade
- Why Uncut Plasmid DNA on Agarose Gel Has 3 Bands
- AAV6.2-CMV-GFP and AAV6.2-CMV-iCre Ready to Package
- LV-Syn-GFP-shRNAmir-WPRE Ready to Package to Knock Down Gene Expression in Neurons
- AAV(cc47)-CMV-GFP is Ready to Package
- AAV(MYO)-CMV-GFP is Ready to Package
- AAV(REC2)-CMV-GFP is Ready to Package
- AAV Rh20 VP1 Gene
- AAV Rec2 Capsid Sequence
- Homemade qPCR Mix Recipe
- Home made qPCR Master Mix
- Nanopore Sequencing: Principles, Platforms and Advantages
- Nanopore Sequencing
- ssAAV9-CMV-SecNanoLuc & scAAV9-CMV-SecNanoLuc, Ready to Package
- AAV(BI30)-CAG-GFP-3xmiR122 is Ready to Package for the Transduction of the Endothelial Cells of CNS
- AAV(9-X1.1)-CMV-GFP is Ready to Package for the Transduction of the Endothelial Cells of CNS
- The Principle of Transformation
- IRES or 2A in my polycistronic expression cassette, which one is better?
- AAV[MyoAAV(2A)]-CMV-GFP and AAV[MyoAAV(4E)]-CMV-GFP Ready to Package
- How Orbital Diameter and Shaker Agitation Rate Affect Bacteria Growth
Categories
Archives
M | T | W | T | F | S | S |
---|---|---|---|---|---|---|
1 | 2 | |||||
3 | 4 | 5 | 6 | 7 | 8 | 9 |
10 | 11 | 12 | 13 | 14 | 15 | 16 |
17 | 18 | 19 | 20 | 21 | 22 | 23 |
24 | 25 | 26 | 27 | 28 |