Skip to content

Adeno-associated Virus (AAV)

Primers for rAAV qPCR Titration

Cytomegalovirus (CMV) Promoter Assay Forward: 5-CATCTACGTATTAGTCATCGCTATTACCA-3 Reverse: 5-GAAATCCCCGTGAGTCAAACC-3 Probe: 5-6FAM-TCAATGGGCGTGGATAG-MGBNFQ-3 Human Thyroxine-binding Globulin (TBG) Promoter Assay Forward: 5-AAACTGCCAATTCCACTGCTG-3 Reverse: 5-CCATAGGCAAAAGCACCAAGA-3 Probe: 5-6FAM-TTGGCCCAATAGTGAGAACTTTTTCCTGC-TAMRA-3 Enhanced Green Fluorescent Protein (eGFP) Assay Forward: 5-AGCAAAGACCCCAACGAGAA-3 […]

rAAV Average Molecular Weight

Adeno-associated virus (AAV) is a parvovirus and is composed of three structural proteins and a linear, single-stranded DNA (ssDNA) genome of approximately 4.7 kb (17). The particle has icosahedral symmetry and a […]

AAV VP1 Sequence Blast Serotype PHP.eB vs Serotype PHP.S

Query 1 MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLD 60 MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLD Sbjct 1 MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLD 60 Query 61 KGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQ 120 KGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQ Sbjct 61 KGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQ 120 Query 121 AKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTE 180 AKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTE Sbjct 121 AKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTE 180 Query 181 SVPDPQPIGEPPAAPSGVGSLTMASGGGAPVADNNEGADGVGSSSGNWHCDSQWLGDRVI […]

AAV VP1 Sequence for Serotype PHP.S

1 atggctgccg atggttatct tccagattgg ctcgaggaca accttagtga aggaattcgc 61 gagtggtggg ctttgaaacc tggagcccct caacccaagg caaatcaaca acatcaagac 121 aacgctcgag gtcttgtgct tccgggttac aaataccttg gacccggcaa cggactcgac 181 aagggggagc cggtcaacgc agcagacgcg gcggccctcg agcacgacaa ggcctacgac 241 cagcagctca […]

AAV VP1 Sequence Blast Serotype PHP.B vs Serotype PHP.eB

Query 1 MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLD 60 MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLD Sbjct 1 MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLD 60 Query 61 KGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQ 120 KGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQ Sbjct 61 KGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQ 120 Query 121 AKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTE 180 AKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTE Sbjct 121 AKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTE 180 Query 181 SVPDPQPIGEPPAAPSGVGSLTMASGGGAPVADNNEGADGVGSSSGNWHCDSQWLGDRVI […]

Synthetic AAV-PHP.eB Capsid Protein Gene, Complete Cds

1 atggctgccg atggttatct tccagattgg ctcgaggaca accttagtga aggaattcgc 61 gagtggtggg ctttgaaacc tggagcccct caacccaagg caaatcaaca acatcaagac 121 aacgctcgag gtcttgtgct tccgggttac aaataccttg gacccggcaa cggactcgac 181 aagggggagc cggtcaacgc agcagacgcg gcggccctcg agcacgacaa ggcctacgac 241 cagcagctca […]