Skip to content

Adeno-associated Virus (AAV)

AAV VP1 Sequence Blast Serotype PHP.eB vs Serotype PHP.S

Query 1 MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLD 60 MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLD Sbjct 1 MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLD 60 Query 61 KGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQ 120 KGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQ Sbjct 61 KGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQ 120 Query 121 AKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTE 180 AKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTE Sbjct 121 AKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTE 180 Query 181 SVPDPQPIGEPPAAPSGVGSLTMASGGGAPVADNNEGADGVGSSSGNWHCDSQWLGDRVI […]

AAV VP1 Sequence for Serotype PHP.S

1 atggctgccg atggttatct tccagattgg ctcgaggaca accttagtga aggaattcgc 61 gagtggtggg ctttgaaacc tggagcccct caacccaagg caaatcaaca acatcaagac 121 aacgctcgag gtcttgtgct tccgggttac aaataccttg gacccggcaa cggactcgac 181 aagggggagc cggtcaacgc agcagacgcg gcggccctcg agcacgacaa ggcctacgac 241 cagcagctca […]

AAV VP1 Sequence Blast Serotype PHP.B vs Serotype PHP.eB

Query 1 MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLD 60 MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLD Sbjct 1 MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLD 60 Query 61 KGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQ 120 KGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQ Sbjct 61 KGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQ 120 Query 121 AKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTE 180 AKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTE Sbjct 121 AKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTE 180 Query 181 SVPDPQPIGEPPAAPSGVGSLTMASGGGAPVADNNEGADGVGSSSGNWHCDSQWLGDRVI […]

Synthetic AAV-PHP.eB Capsid Protein Gene, Complete Cds

1 atggctgccg atggttatct tccagattgg ctcgaggaca accttagtga aggaattcgc 61 gagtggtggg ctttgaaacc tggagcccct caacccaagg caaatcaaca acatcaagac 121 aacgctcgag gtcttgtgct tccgggttac aaataccttg gacccggcaa cggactcgac 181 aagggggagc cggtcaacgc agcagacgcg gcggccctcg agcacgacaa ggcctacgac 241 cagcagctca […]