MAADGYLPDWLEDTLSEGIRQWWKLKPGPPPPKPAERHKDDSRGLVLPGYKYLGPFNGLDKGEPVNEADAAALEHDKAYDRQLDSGDNPYLKYNHAD AEFQERLKEDTSFGGNLGRAVFQAKKRVLEPLGLVEEPVKTAPGKKRPVEHSPVEPDSSSGTGKAGQQPARKRLNFGQTGDADSVPDPQPLGQPPAAPSGLGT NTMATGSGAPMADNNEGADGVGNSSGNWHCDSTWMGDRVITTSTRTWALPTYNNHLYKQISSQSGASNDNHYFGYSTPWGYFDFNRFHCHFSPRDWQRLI NNNWGFRPKRLNFKLFNIQVKEVTQNDGTTTIANNLTSTVQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMVPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLR TGNNFTFSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYLYYLSRTNTPSGTTTQSRLQFSQAGASDIRDQSRNWLPGPCYRQQRVSKTSADNNNSEYSWTGATKY HLNGRDSLVNPGPAMASHKDDEEKFFPQSGVLIFGKQGSEKTNVDIEKVMITDEEEIRTTNPVATEQYGSVSTNLQRGQRGNRGTEWDAQAATADVNTQGVLP GMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQILIKNTPVPANPSTTFSAAKFASFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYNK SVNVDFTVDTNGVYSEPRPIGTRYLTRNL*
Recent Posts
- AAV Rh32.33 VP1 Gene
- AAVhu68-CMV-GFP and AAVhu68-CAG-fLuc Ready to Package
- Deletion of the B-B’ or C-C’ in AAV ITR has a minimal impact on AAV production but increases transgene expression
- How Does pH Affect DNA Stability?
- AAV(2-Retro)-Syn-axon-GCaMP6s Ready to Pacakge
- What is pH Value of ddH2O?
- Liver-detargeted AAV(9.61)-CMV-GFP Ready to Package for Specific Heart and Smooth Muscle Transductoin
- Liver-detargeted AAV(9.45)-CMV-GFP Ready to Package for Specific Heart and Smooth Muscle Transductoin
- AAV(BI-hTFR1)-CMV-GFP Ready to Package for Brain-wide Gene Delivery
- How many adenovirus particles can be made in one HEK293 cell?
- AAV(BI30)-CBh-Cre-ERT2 Ready to Package for Tamoxifen-induced Cre Expression in Endothelial Cell of CNS
- AAV(Myo4A)-CMV-GFP is Ready to Package
- How to Amplify An Adenovirus
- AAV(Rec2.V7)-CAG-EGFP Ready to Package
- How to Improve 2A Linker Cleavage Efficiency
- AAVhu.14 Capsid Protein VP1 (Cap) Gene
- AAVhu.32 Capsid Protein VP1 (cap) Gene
- AAVhu68 Capsid Protein (VP1) Gene
- AAVrh.74 Capsid Sequence
- How to avoid cross-contamination in qPCR
- Reduce the risk of cross-contamination from the amplicon/template and previous reactions for a qPCR
- Difference between dye-based vs probe-based qPCR
- OmpA Signal for Protein Expression
- Isopycnic Centrifugation
- High-cell-density cultivation (HCDC)
- Is Kozak sequence essential for transgene expression in lentivirus?
- How to remove protein from PEG precipitated lentivirus
- Primers and probes used for rAAV quantitative analysis
- Quantification for residual host cell DNA contamination in the rAAV prep via qPCR or ddPCR analysis targeting highly repetitive genome sequences
- How to protect RNA from degradation?
- What is the main reason for RNA being unstable?
- Why Are Transgenes Cloned into Lentiviral Vectors Without a Poly(A) Signal?
- AAV(Myo1A)-CMV-GFP Ready to Package
- Potential Reasons for Lack of Supercoiled DNA
- Transfection Efficiency: What Makes Plasmid DNA Transfection Grade
- Why Uncut Plasmid DNA on Agarose Gel Has 3 Bands