Skip to content

Adeno-associated Virus (AAV)

Membrane Information

Polytetrafluoroethylene (PTFE)Hydrophobic membrane. Resistant to organic solvents as well as strong acids and bases. Low protein binding. Low in extractables. Main applications are the filtration of non-aqueous samples. Prior to […]

qPCR Determination of Mycoplasma in AAV Samples

Generate primers are designed to amplify the mycoplasma 16S rDNA via qPCR. Primer sequence:16S U1 (forward) 5’–GTTTGATCCTGGCTCAGGAYDAAC– 3’ **16S U8 (reverse) 5’–GAAAGGAGGTRWTCCAYCCSCAC– 3’ *** Y = C or T; D […]

AAV10 VP1 Sequence

atggctgctgacggttatcttccagattggctcgaggacaacctctctgagggcattcgcgagtggtgggacctgaaacctggagcccccaagcccaaggccaaccagcagaagcaggacgacggccggggtctggtgcttcctggctacaagtacctcggacccttcaacggactcgacaagggggagcccgtcaacgcggcggacgcagcggccctcgagcacgacaaggcctacgaccagcagctcaaagcgggtgacaatccgtacctgcggtataaccacgccgacgccgagtttcaggagcgtctgcaagaagatacgtcttttgggggcaacctcgggcgagcagtcttccaggccaagaagcgggttctcgaacctctcggtctggttgaggaagctgctaagacggctcctggaaagaagagaccggtagaaccgtcacctcagcgttcccccgactcctccacgggcatcggcaagaaaggccagcagcccgctaaaaagagactgaactttgggcagactggcgagtcagagtcagtccccgaccctcaaccaatcggagaaccaccagcaggcccctctggtctgggatctggtacaatggctgcaggcggtggcgctccaatggcagacaataacgaaggcgccgacggagtgggtagttcctcaggaaattggcattgcgattccacatggctgggcgacagagtcatcaccaccagcacccgaacctgggccctgcccacctacaacaaccacctctacaagcaaatctccaacgggacatcgggaggaagcaccaacgacaacacctacttcggctacagcaccccctgggggtattttgacttcaacagattccactgccacttctcaccacgtgactggcagcgactcatcaacaacaactggggattccggccaaaaagactcagcttcaagctcttcaacatccaggtcaaggaggtcacgcagaatgaaggcaccaagaccatcgccaataaccttaccagcacgattcaggtatttacggactcggaataccagctgccgtacgtcctcggctccgcgcaccagggctgcctgcctccgttcccggcggatgtcttcatgattccccagtacggctacctgacactgaacaatggaagtcaagccgtaggccgttcctccttctactgcctggaatattttccatctcaaatgctgcgaactggaaacaattttgaattcagctacaccttcgaggacgtgcctttccacagcagctacgcacacagccagagcttggaccgactgatgaatcctctcattgaccagtacctgtactacttatccagaactcagtccacaggaggaactcaaggtacccagcaattgttattttctcaagctgggcctgcaaacatgtcggctcaggccaagaactggctgcctggaccttgctaccggcagcagcgagtctccacgacactgtcgcaaaacaacaacagcaactttgcttggactggtgccaccaaatatcacctgaacggaagagactctctggtgaatcccggtgtcgccatggcaacccacaaggacgacgaggaacgcttcttcccgtcgagcggagtcctgatgtttggaaaacagggtgctggaagagacaatgtggactacagcagcgttatgctaacaagcgaagaagaaattaaaaccactaaccctgtagccacagaacaatacggcgtggtggctgacaacttgcagcaagccaatacagggcctattgtgggaaatgtcaacagccaaggagccttacctggcatggtctggcagaaccgagacgtgtacctgcagggtcccatctgggccaagattcctcacacggacggcaactttcacccgtctcctctgatgggcggctttggacttaaacacccgcctccacagatcctgatcaagaacacgccggtacctgcggatcctccaacaacgttcagccaggcgaaattggcttccttcatcacgcagtacagcaccggacaggtcagcgtggaaatcgagtgggagctgcagaaggagaacagcaaacgctggaacccagagattcagtacacttcaaactactacaaatctacaaatgtggactttgctgtcaatacagagggaacttattctgagcctcgccccattggtactcgttatctgacacgtaatctgtaa

Human ChAT Promoter

cccgggagcagggggtggggaaggaggagcagtggctggtggcaagtctgagccaggacatagccgatgacagcctgtgaatgaccggccagactggggttggaccttcggggcagagcaggcagcccttggaaagccaggctggtaggagcatgggtgggaggcacaaaacacagacaaacagacatatatacacatatatcctctaggcatctccgaggagtgatggaggagagagttggtaggtgggaccacaggaaaccatcccacccagctctgccttcttcaagctcagggtccctgaagcctgactagtgtctcccgaatgggggaggggggggctctgggcagagcaaaaggaggcattggctgcatgtcttagggcctttaccaactgaccttgtccttgctgtcctctcaaaagactgccatgctccggtgaatcctcaccaggacgccacctctttcactttgcagttgggggcagcccctacgaacccacagcactgggaggcgtgggaacaagcctgtggagagtgtccctgcactgtgccagcaagggctttacattctctgcccagcactgcaaggcagccccaggctcctccatccttgggcctggttcatccatctttctggactctctgttcctggcaacaaccctgccagtcccgatacatgggcggtgcttgcctctgggtaggggtggtgttgggtggggagaggggtgaggaaattagctaaacctcagctttagacttgagagaatagagggtgggctggtggaaaacatgagtatgtgcctgtggaggcttaggttcagggggatctcagagggtagcaattgtgacccacagcctaataataacagtctttgccctcttggcctggctc

A Novel AAV Serotype B1 for CNS Transduction

VP1 Amino Acid Sequence of AAV-B1: MAADGYLPDWLEDNLSEGIREWWDLKPGAPKPKANQQKQDDGRGLVLPGYKYLGPFNGLDKGEPVNAADAAALEHDKAYDQQLKAGDNPYLRYNHAD VEFQERLQEDTSFGGNLGRAVFQAKKRVLEPFGLVEEGAKTAPGKKRPVEQSPQEPDSSSGIGKKGQQPARKRLNFGQTGDSESVPDPQPLGEPPAAPSGVG PNTMAAGGGAPMADNNEGADGVGNSSGNWHCDSTWMGDRVITTSTRTWALPTYNNHLYKQISNGTSGGSTNDNTYFGYSTPWGYFDFNRFHCHFSPRD WQRLINNNWGFRPKRLSFKLFNIQVKEVTQNEGTKTIANNLTSTIQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMIPQYGYLTLNNGSQAVGRSSFYCLEYF PSQMLRTGNNFEFSYQFEDVPFHSSYAHSQSLDRLMNPLIDQYLYYLSRTQSTGGTARTQQLLFSQAGPNTMANQAKNWLPGPCYRQQRVSTTTGQNNN SNSAWTAGTKYHLNGRNSLANPGIAMATHKDDEERFFPSNGILIFGKQNAARDNADYSDVMLTSEEEIKTTNPVATEEYGIVADNLQQQNTAPQIGTVNSQ GALPGMVWQNRDVYLQGPIWAKIPHTDGNFHPSPLMGGFGLKHPPPQILIKNTPVPADPPTTFNQSKLNSFITQYSTGQVSVEIEWELQKENSKRWNPEI QYTSNYYKSTSVDFAVNTEGVYSEPRPIGTRYLTRNL