- AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE)
- Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL)
- polyglutamate tag, a peptide binding efficiently to anion-exchange resin such as Mono-Q (EEEEEE)
- E-tag, a peptide recognized by an antibody (GAPVPYPDPLEPR)
- FLAG-tag, a peptide recognized by an antibody (DYKDDDDK)
- HA-tag, a peptide recognized by an antibody (YPYDVPDYA)
- His-tag, 5-10 histidines bound by a nickel or cobalt chelate (HHHHHH)
- Myc-tag, a short peptide recognized by an antibody (EQKLISEEDL)
- S-tag (KETAAAKFERQHMDS)
- SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP)
- Softag 1, for mammalian expression (SLAELLNAGLGGS)
- Softag 3, for prokaryotic expression (TQDPSRVG)
- Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK)
- TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC)
- V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST)
- VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK)
- Xpress tag (DLYDDDDK)
- Isopeptag, a peptide which binds covalently to pilin-C protein (TDKDMTITFTNKKDAE)
- SpyTag, a peptide which binds covalently to SpyCatcher protein (AHIVMVDAYKPTK)
- BCCP (Biotin Carboxyl Carrier Protein), a protein domain biotinylated by BirA enabling recognition by streptavidin
- Glutathione-S-transferase-tag, a protein which binds to immobilized glutathione
- Green fluorescent protein-tag, a protein which is spontaneously fluorescent and can be bound by nanobodies
- Halo-tag, a mutated hydrolase that covalently attaches to the HaloLink™ Resin
- Maltose binding protein-tag, a protein which binds to amylose agarose
- Nus-tag
- Thioredoxin-tag
- Fc-tag, derived from immunoglobulin Fc domain, allow dimerization and solubilization. Can be used for purification on Protein-A Sepharose
- Designed Intrinsically Disordered tags containing disorder promoting amino acids (P,E,S,T,A,Q,G,..)